TGF α (1-50) (rat) trifluoroacetate salt,CAS: 89899-53-6
TGF α (1-50) (rat) trifluoroacetate salt
Product description
TGFα(1-50) (rat) trifluoroacetate salt ,CAS: 89899-53-6 from ruixi. It can be applied to Cell culture and regenerative medicine.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 89899-53-6 |
Sequence | VVSHFNKCPDSHTQYCFHGTCRFLVQEEKPACVCHSGYVGVRCEHADLLA |
Molecular Formula | C₂₄₄H₃₆₁N₇₁O₇₁S₆ |
Storage | -20℃,protected from light and moisture |
Transportation | 4-25℃ temperature for up to 2 weeks |
Stability | 1 year |
Document
Related Product